PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009130657.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 319aa    MW: 37786.1 Da    PI: 6.2167
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009130657.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.13.1e-2546128186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++L+ +r+e+++++ ++k++k lWe v++km+++gf rs++qCk+kw+nl +ryk+++++e +    s++++p++++++
  XP_009130657.1  46 QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFARSAEQCKSKWKNLVTRYKACETTEPEA---SRQQFPFYSEIQ 128
                     7********************************************************************85...56679***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.75E-2345107No hitNo description
PfamPF138375.7E-2146129No hitNo description
Gene3DG3DSA:1.10.10.604.6E-446102IPR009057Homeodomain-like
PROSITE profilePS500908.03747103IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDRRNPFHHH EHQLYHLIQQ QQLPLPPQST MAAMDSGGGG GERIPQWSIE ETKELLGIRE  60
ELDQTFMETK RNKLLWEVVA AKMADKGFAR SAEQCKSKWK NLVTRYKACE TTEPEASRQQ  120
FPFYSEIQSI FTARMQRNLW SEPTEGSTSS KRKHHQFSSD EEEEDQVEEP NQDINEELLS  180
FIETDKKEAE VITTSTSTDP RKRVKKGKGI FTGSTKAETA GSTLKEILED FMRQTVKMEK  240
EWIASWEMKE REREKREHER RRRMADLEEE RAAAERRWME REDERRLREE ARARKRDTLI  300
DALLNKLNRD HNDDHYQGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893620.0AC189362.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045I17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130657.10.0PREDICTED: trihelix transcription factor GT-3a-like
SwissprotQ9SDW01e-142TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A078FGM70.0A0A078FGM7_BRANA; BnaA03g00390D protein
STRINGBra005688.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-129Trihelix family protein